Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187598] (88 PDB entries) |
Domain d4a63j2: 4a63 J:1056-1122 [234039] Other proteins in same PDB: d4a63a_, d4a63b1, d4a63c_, d4a63d1, d4a63e_, d4a63f1, d4a63g_, d4a63h1, d4a63i_, d4a63j1, d4a63k_, d4a63l1 automated match to d1ycsb2 complexed with act, zn |
PDB Entry: 4a63 (more details), 2.27 Å
SCOPe Domain Sequences for d4a63j2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a63j2 b.34.2.0 (J:1056-1122) automated matches {Human (Homo sapiens) [TaxId: 9606]} imnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllg lyprikp
Timeline for d4a63j2: