| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries) |
| Domain d4a63d2: 4a63 D:1056-1120 [234037] Other proteins in same PDB: d4a63a1, d4a63a2, d4a63b1, d4a63c1, d4a63c2, d4a63d1, d4a63e1, d4a63e2, d4a63f1, d4a63g1, d4a63g2, d4a63h1, d4a63i1, d4a63i2, d4a63j1, d4a63k1, d4a63k2, d4a63l1 automated match to d1ycsb2 complexed with act, zn |
PDB Entry: 4a63 (more details), 2.27 Å
SCOPe Domain Sequences for d4a63d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a63d2 b.34.2.0 (D:1056-1120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
imnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllg
lypri
Timeline for d4a63d2: