SCOPe 2.05: Domain d4a63d1: 4a63 D:925-1055

Lineage for d4a63d1 (4a63 D:925-1055)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187689] (6 PDB entries)

8. Domain d4a63d1: 4a63 D:925-1055 [234036]
   Other proteins in same PDB: d4a63a_, d4a63b2, d4a63c_, d4a63d2, d4a63e_, d4a63f2, d4a63g_, d4a63h2, d4a63i_, d4a63j2, d4a63k_, d4a63l2
   automated match to d1ycsb1
   complexed with act, zn

Details for d4a63d1

PDB Entry: 4a63, 2.27 Å

PDB Description: crystal structure of the p73-aspp2 complex at 2.6a resolution

PDB Compounds: (D:) apoptosis stimulating of p53 protein 2

SCOPe Domain Sequences for d4a63d1:

Sequence; same for both SEQRES and ATOM records:

>d4a63d1 d.211.1.1 (D:925-1055) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfgvn
vnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytqcs
qflygvqekmg

Timeline for d4a63d1:

• d4a63d1 first appeared in SCOPe 2.03
  
• d4a63d1 appears in SCOPe 2.04
  
• d4a63d1 appears in SCOPe 2.06
  
• d4a63d1 appears in the current release, SCOPe 2.08