| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
| Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
| Protein automated matches [190101] (7 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries) |
| Domain d4a63f1: 4a63 F:925-1055 [234032] Other proteins in same PDB: d4a63a1, d4a63a2, d4a63b2, d4a63c1, d4a63c2, d4a63d2, d4a63e1, d4a63e2, d4a63f2, d4a63g1, d4a63g2, d4a63h2, d4a63i1, d4a63i2, d4a63j2, d4a63k1, d4a63k2, d4a63l2 automated match to d1ycsb1 complexed with act, zn applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 4a63 (more details), 2.27 Å
SCOPe Domain Sequences for d4a63f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a63f1 d.211.1.1 (F:925-1055) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfgvn
vnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytqcs
qflygvqekmg
Timeline for d4a63f1: