Lineage for d4a61a1 (4a61 A:2-157)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2883901Species Escherichia coli [TaxId:562] [234029] (1 PDB entry)
  8. 2883902Domain d4a61a1: 4a61 A:2-157 [234030]
    Other proteins in same PDB: d4a61a3
    automated match to d1mwma1
    complexed with anp, mg

Details for d4a61a1

PDB Entry: 4a61 (more details), 2 Å

PDB Description: ParM from plasmid R1 in complex with AMPPNP
PDB Compounds: (A:) Plasmid segregation protein parM

SCOPe Domain Sequences for d4a61a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a61a1 c.55.1.1 (A:2-157) automated matches {Escherichia coli [TaxId: 562]}
lvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpis
pdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenier
kkanfrkkitlnggdtftikdvkvmpesipagyevl

SCOPe Domain Coordinates for d4a61a1:

Click to download the PDB-style file with coordinates for d4a61a1.
(The format of our PDB-style files is described here.)

Timeline for d4a61a1: