SCOPe 2.03: Domain d4a4ia_: 4a4i A:

Lineage for d4a4ia_ (4a4i A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225402] (5 PDB entries)

8. Domain d4a4ia_: 4a4i A: [234027]
   automated match to d3i2za_
   complexed with gol, so4

Details for d4a4ia_

PDB Entry: 4a4i, 1.95 Å

PDB Description: Crystal structure of the human Lin28b cold shock domain

PDB Compounds: (A:) protein lin-28 homolog b

SCOPe Domain Sequences for d4a4ia_:

Sequence; same for both SEQRES and ATOM records:

>d4a4ia_ b.40.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrgtghckwfnvrmgfgfisminregspldipvdvfvhqsklfmegfrslkegepveft
fkksskglesirvtgpggspclgs

Timeline for d4a4ia_:

• d4a4ia_ is new in SCOPe 2.03-stable
  
• d4a4ia_ appears in SCOPe 2.04
  
• d4a4ia_ appears in the current release, SCOPe 2.08