Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225402] (5 PDB entries) |
Domain d4a4ia_: 4a4i A: [234027] automated match to d3i2za_ complexed with gol, so4 |
PDB Entry: 4a4i (more details), 1.95 Å
SCOPe Domain Sequences for d4a4ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a4ia_ b.40.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vlrgtghckwfnvrmgfgfisminregspldipvdvfvhqsklfmegfrslkegepveft fkksskglesirvtgpggspclgs
Timeline for d4a4ia_: