Class b: All beta proteins [48724] (174 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (11 species) not a true protein |
Species Influenza A virus [TaxId:11320] [187142] (15 PDB entries) |
Domain d3zpbe_: 3zpb E: [233993] Other proteins in same PDB: d3zpbf_ automated match to d3zp6e_ complexed with nag; mutant |
PDB Entry: 3zpb (more details), 2.6 Å
SCOPe Domain Sequences for d3zpbe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zpbe_ b.19.1.2 (E:) automated matches {Influenza A virus [TaxId: 11320]} dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh pndaadqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlatglrnsp
Timeline for d3zpbe_: