Lineage for d3wd8c1 (3wd8 C:-1-235)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881785Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1881786Protein automated matches [196909] (52 species)
    not a true protein
  7. 1881880Species Citrus microcarpa [TaxId:164113] [227815] (2 PDB entries)
  8. 1881889Domain d3wd8c1: 3wd8 C:-1-235 [233952]
    automated match to d3wd8d1
    complexed with gol

Details for d3wd8c1

PDB Entry: 3wd8 (more details), 2.46 Å

PDB Description: TypeIII polyketide synthases
PDB Compounds: (C:) Type III polyketide synthase quinolone synthase

SCOPe Domain Sequences for d3wd8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wd8c1 c.95.1.0 (C:-1-235) automated matches {Citrus microcarpa [TaxId: 164113]}
gsmakvknflnakrskgpasilaigtanpptcfnqsdypdfyfrvtdcehktelkdkfkr
icdrsavkkrylhvteevlkenpsmrsynapsldarqallieqvpklgkeaaakaikewg
qplskithlvfsamagvdipgadlrlmnllglepsvkrlmiysqgcfiggaaircakdfa
ennagarvlvvfsdimnmyfhepqeahldilvgqavfgdgaaavivgadpevsierp

SCOPe Domain Coordinates for d3wd8c1:

Click to download the PDB-style file with coordinates for d3wd8c1.
(The format of our PDB-style files is described here.)

Timeline for d3wd8c1: