SCOPe 2.05: Domain d3wbrf_: 3wbr F:

Lineage for d3wbrf_ (3wbr F:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (65 PDB entries)

8. Domain d3wbrf_: 3wbr F: [233947]
   automated match to d3wbra_

Details for d3wbrf_

PDB Entry: 3wbr, 2.2 Å

PDB Description: crystal structure of carbohydrate recognition domain of blood dendritic cell antigen-2 (bdca2) lectin (crystal form-3)

PDB Compounds: (F:) C-type lectin domain family 4 member C

SCOPe Domain Sequences for d3wbrf_:

Sequence, based on SEQRES records:

>d3wbrf_ d.169.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchvpq
ksickmkk

Sequence, based on observed residues (ATOM records):

>d3wbrf_ d.169.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrssewgwndihchvpqk
sickmkk

Timeline for d3wbrf_:

• d3wbrf_ first appeared in SCOPe 2.03
  
• d3wbrf_ appears in SCOPe 2.04
  
• d3wbrf_ appears in SCOPe 2.06
  
• d3wbrf_ appears in the current release, SCOPe 2.08