Lineage for d3wbrg_ (3wbr G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235412Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2235413Protein automated matches [190159] (16 species)
    not a true protein
  7. 2235465Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)
  8. 2235667Domain d3wbrg_: 3wbr G: [233945]
    Other proteins in same PDB: d3wbra2, d3wbrb2, d3wbrc2
    automated match to d3wbra_

Details for d3wbrg_

PDB Entry: 3wbr (more details), 2.2 Å

PDB Description: crystal structure of carbohydrate recognition domain of blood dendritic cell antigen-2 (bdca2) lectin (crystal form-3)
PDB Compounds: (G:) C-type lectin domain family 4 member C

SCOPe Domain Sequences for d3wbrg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wbrg_ d.169.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchvpq
ksickmk

SCOPe Domain Coordinates for d3wbrg_:

Click to download the PDB-style file with coordinates for d3wbrg_.
(The format of our PDB-style files is described here.)

Timeline for d3wbrg_: