SCOPe 2.08: Domain d3w67a2: 3w67 A:91-275

Lineage for d3w67a2 (3w67 A:91-275)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families)
   automatically mapped to Pfam PF00650

5. Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins)
   Pfam PF00650

6. Protein automated matches [233926] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [233927] (2 PDB entries)

8. Domain d3w67a2: 3w67 A:91-275 [233928]
   Other proteins in same PDB: d3w67a1, d3w67b1, d3w67c1, d3w67d1
   automated match to d1oiza2
   complexed with 3pt, viv

Details for d3w67a2

PDB Entry: 3w67, 2.61 Å

PDB Description: Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(3,4)-bisphosphate

PDB Compounds: (A:) alpha-tocopherol transfer protein

SCOPe Domain Sequences for d3w67a2:

Sequence; same for both SEQRES and ATOM records:

>d3w67a2 c.13.1.1 (A:91-275) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
silgllkagyhgvlrsrdstgsrvliyriaywdpkvftaydvfrvslitselivqevetq
rngvkaifdlegwqvshafqitpsvakkiaavltdsfplkvrgihlinepvifhavfsmi
kpfltekikdrihlhgnnykssmlqhfpdilpreyggkefsmedicqewtnfimksedyl
ssise

Timeline for d3w67a2:

• d3w67a2 first appeared in SCOPe 2.03
  
• d3w67a2 appears in SCOPe 2.07