Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) automatically mapped to Pfam PF00650 |
Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins) Pfam PF00650 |
Protein automated matches [233926] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [233927] (2 PDB entries) |
Domain d3w67a2: 3w67 A:91-275 [233928] Other proteins in same PDB: d3w67a1, d3w67b1, d3w67c1, d3w67d1 automated match to d1oiza2 complexed with 3pt, viv |
PDB Entry: 3w67 (more details), 2.61 Å
SCOPe Domain Sequences for d3w67a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w67a2 c.13.1.1 (A:91-275) automated matches {Mouse (Mus musculus) [TaxId: 10090]} silgllkagyhgvlrsrdstgsrvliyriaywdpkvftaydvfrvslitselivqevetq rngvkaifdlegwqvshafqitpsvakkiaavltdsfplkvrgihlinepvifhavfsmi kpfltekikdrihlhgnnykssmlqhfpdilpreyggkefsmedicqewtnfimksedyl ssise
Timeline for d3w67a2: