Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein automated matches [190228] (10 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [187324] (54 PDB entries) |
Domain d3w1xa_: 3w1x A: [233904] automated match to d3w1aa_ complexed with fmn, gol, nco, xro |
PDB Entry: 3w1x (more details), 1.45 Å
SCOPe Domain Sequences for d3w1xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w1xa_ c.1.4.1 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]} mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr tleefrgrvktie
Timeline for d3w1xa_: