SCOPe 2.03: Domain d3w1qb_: 3w1q B:

Lineage for d3w1qb_ (3w1q B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein automated matches [190228] (10 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [187324] (54 PDB entries)

8. Domain d3w1qb_: 3w1q B: [233897]
   automated match to d3w1aa_
   complexed with fmn, gol, nco, yro

Details for d3w1qb_

PDB Entry: 3w1q, 1.85 Å

PDB Description: Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with NL-2

PDB Compounds: (B:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d3w1qb_:

Sequence; same for both SEQRES and ATOM records:

>d3w1qb_ c.1.4.1 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

Timeline for d3w1qb_:

• d3w1qb_ is new in SCOPe 2.03-stable
  
• d3w1qb_ appears in SCOPe 2.04
  
• d3w1qb_ appears in the current release, SCOPe 2.08