Lineage for d3vxta2 (3vxt A:112-200)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751821Domain d3vxta2: 3vxt A:112-200 [233895]
    Other proteins in same PDB: d3vxta1, d3vxtb1, d3vxtb2, d3vxtc1, d3vxtd1, d3vxtd2
    automated match to d3vxtc2

Details for d3vxta2

PDB Entry: 3vxt (more details), 2.5 Å

PDB Description: t36-5 tcr specific for hla-a24-nef134-10
PDB Compounds: (A:) T36-5 TCR alpha chain

SCOPe Domain Sequences for d3vxta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vxta2 b.1.1.2 (A:112-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3vxta2:

Click to download the PDB-style file with coordinates for d3vxta2.
(The format of our PDB-style files is described here.)

Timeline for d3vxta2: