SCOPe 2.03: Domain d3vxta1: 3vxt A:2-111

Lineage for d3vxta1 (3vxt A:2-111)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d3vxta1: 3vxt A:2-111 [233877]
   Other proteins in same PDB: d3vxta2, d3vxtc2
   automated match to d3vxtc1

Details for d3vxta1

PDB Entry: 3vxt, 2.5 Å

PDB Description: t36-5 tcr specific for hla-a24-nef134-10

PDB Compounds: (A:) T36-5 TCR alpha chain

SCOPe Domain Sequences for d3vxta1:

Sequence; same for both SEQRES and ATOM records:

>d3vxta1 b.1.1.0 (A:2-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylwgtynqggklifgqgtelsvkpn

Timeline for d3vxta1:

• d3vxta1 is new in SCOPe 2.03-stable
  
• d3vxta1 appears in SCOPe 2.04
  
• d3vxta1 appears in the current release, SCOPe 2.08