SCOPe 2.04: Domain d3vi3a2: 3vi3 A:450-601

Lineage for d3vi3a2 (3vi3 A:450-601)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.15: Integrin domains [69179] (2 families)

5. Family b.1.15.0: automated matches [233856] (1 protein)
   not a true family

6. Protein automated matches [233857] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [233858] (5 PDB entries)

8. Domain d3vi3a2: 3vi3 A:450-601 [233860]
   Other proteins in same PDB: d3vi3a1, d3vi3c1, d3vi3e1, d3vi3e2, d3vi3l1, d3vi3l2
   automated match to d1m1xa1
   complexed with ca, mg, nag

Details for d3vi3a2

PDB Entry: 3vi3, 2.9 Å

PDB Description: crystal structure of alpha5beta1 integrin headpiece (ligand-free form)

PDB Compounds: (A:) Integrin alpha-5

SCOPe Domain Sequences for d3vi3a2:

Sequence; same for both SEQRES and ATOM records:

>d3vi3a2 b.1.15.0 (A:450-601) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pivsasasltifpamfnpeerscslegnpvacinlsfclnasgkhvadsigftvelqldw
qkqkggvrralflasrqatltqtlliqngaredcremkiylrnesefrdklspihialnf
sldpqapvdshglrpalhyqsksriedkaqil

Timeline for d3vi3a2:

• d3vi3a2 first appeared in SCOPe 2.03
  
• d3vi3a2 appears in SCOPe 2.05
  
• d3vi3a2 appears in the current release, SCOPe 2.08