Lineage for d3vi3c2 (3vi3 C:450-600)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038467Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2038496Family b.1.15.0: automated matches [233856] (1 protein)
    not a true family
  6. 2038497Protein automated matches [233857] (1 species)
    not a true protein
  7. 2038498Species Human (Homo sapiens) [TaxId:9606] [233858] (12 PDB entries)
  8. 2038509Domain d3vi3c2: 3vi3 C:450-600 [233859]
    Other proteins in same PDB: d3vi3a1, d3vi3c1, d3vi3e1, d3vi3e2, d3vi3l1, d3vi3l2
    automated match to d1m1xa1
    complexed with ca, mg, nag

Details for d3vi3c2

PDB Entry: 3vi3 (more details), 2.9 Å

PDB Description: crystal structure of alpha5beta1 integrin headpiece (ligand-free form)
PDB Compounds: (C:) Integrin alpha-5

SCOPe Domain Sequences for d3vi3c2:

Sequence, based on SEQRES records: (download)

>d3vi3c2 b.1.15.0 (C:450-600) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pivsasasltifpamfnpeerscslegnpvacinlsfclnasgkhvadsigftvelqldw
qkqkggvrralflasrqatltqtlliqngaredcremkiylrnesefrdklspihialnf
sldpqapvdshglrpalhyqsksriedkaqi

Sequence, based on observed residues (ATOM records): (download)

>d3vi3c2 b.1.15.0 (C:450-600) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pivsasasltifpamfnpeerscslegnpvacinlsfclnasgkhvadsigftvelqldw
qkqralflasrqatltqtlliqngaredcremkiylrnelspihialnfsldpqapvdsh
glrpalhyqsksriedkaqi

SCOPe Domain Coordinates for d3vi3c2:

Click to download the PDB-style file with coordinates for d3vi3c2.
(The format of our PDB-style files is described here.)

Timeline for d3vi3c2: