Lineage for d3vi3c1 (3vi3 C:1-449)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803012Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1803516Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 1803564Family b.69.8.0: automated matches [233848] (1 protein)
    not a true family
  6. 1803565Protein automated matches [233850] (1 species)
    not a true protein
  7. 1803566Species Human (Homo sapiens) [TaxId:9606] [233851] (2 PDB entries)
  8. 1803569Domain d3vi3c1: 3vi3 C:1-449 [233853]
    Other proteins in same PDB: d3vi3a2, d3vi3c2, d3vi3e1, d3vi3e2, d3vi3l1, d3vi3l2
    automated match to d1m1xa4
    complexed with ca, mg, nag

Details for d3vi3c1

PDB Entry: 3vi3 (more details), 2.9 Å

PDB Description: crystal structure of alpha5beta1 integrin headpiece (ligand-free form)
PDB Compounds: (C:) Integrin alpha-5

SCOPe Domain Sequences for d3vi3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vi3c1 b.69.8.0 (C:1-449) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldaeapavlsgppgsffgfsvefyrpgtdgvsvlvgapkantsqpgvlqggavylcpw
gasptqctpiefdskgsrllesslsssegeepveykslqwfgatvrahgssilacaplys
wrtekeplsdpvgtcylstdnftrileyapcrsdfswaagqgycqggfsaeftktgrvvl
ggpgsyfwqgqilsatqeqiaesyypeylinlvqgqlqtrqassiyddsylgysvavgef
sgddtedfvagvpkgnltygyvtilngsdirslynfsgeqmasyfgyavaatdvngdgld
dllvgapllmdrtpdgrpqevgrvyvylqhpagieptptltltghdefgrfgssltplgd
ldqdgyndvaigapfggetqqgvvfvfpggpgglgskpsqvlqplwaashtpdffgsalr
ggrdldgngypdlivgsfgvdkavvyrgr

SCOPe Domain Coordinates for d3vi3c1:

Click to download the PDB-style file with coordinates for d3vi3c1.
(The format of our PDB-style files is described here.)

Timeline for d3vi3c1: