Lineage for d3va8a2 (3va8 A:137-423)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1344084Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1344085Protein automated matches [226923] (45 species)
    not a true protein
  7. 1344191Species Gibberella zeae [TaxId:5518] [233836] (1 PDB entry)
  8. 1344192Domain d3va8a2: 3va8 A:137-423 [233837]
    Other proteins in same PDB: d3va8a1
    automated match to d4it1d2
    complexed with fmt, mg, so4

Details for d3va8a2

PDB Entry: 3va8 (more details), 2 Å

PDB Description: Crystal structure of enolase FG03645.1 (target EFI-502278) from Gibberella zeae PH-1 complexed with magnesium, formate and sulfate
PDB Compounds: (A:) probable dehydratase

SCOPe Domain Sequences for d3va8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3va8a2 c.1.11.0 (A:137-423) automated matches {Gibberella zeae [TaxId: 5518]}
grvrdsvqysaylfykwgghpgdeddeygpaldpegvvkqakkiideygfkaiklkggvf
ppadevaaikalhkafpgvplrldpnaawtvetskwvakelegiveyledpageiegmaa
vakeasmplatnmavvafdhlppsilqdavqvilsdhhfwgglrksqtlasicatwglrl
smhsnshlgislaamthlasatpnldyacdthwpwkrrdedvviegalkwkdggvivpsg
pglgveldrerlaklhqqyvdcglkkrddttymkrfkpefsekiprw

SCOPe Domain Coordinates for d3va8a2:

Click to download the PDB-style file with coordinates for d3va8a2.
(The format of our PDB-style files is described here.)

Timeline for d3va8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3va8a1