Lineage for d3va8a1 (3va8 A:-5-136)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905541Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [233834] (1 PDB entry)
  8. 1905542Domain d3va8a1: 3va8 A:-5-136 [233835]
    Other proteins in same PDB: d3va8a2
    automated match to d4it1d1
    complexed with fmt, mg, so4

Details for d3va8a1

PDB Entry: 3va8 (more details), 2 Å

PDB Description: Crystal structure of enolase FG03645.1 (target EFI-502278) from Gibberella zeae PH-1 complexed with magnesium, formate and sulfate
PDB Compounds: (A:) probable dehydratase

SCOPe Domain Sequences for d3va8a1:

Sequence, based on SEQRES records: (download)

>d3va8a1 d.54.1.0 (A:-5-136) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
nlyfqsmsqrsiikeivitpvafhdmpllnsvgvhepfalrsiieiitedsyglgesygd
sahldrlqkaadkikglsvystnviyqrcveslrndtntggdgmggmvvtasvadkvfsp
fevacldlqgklagisvsdllg

Sequence, based on observed residues (ATOM records): (download)

>d3va8a1 d.54.1.0 (A:-5-136) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
nlyfqsmsqrsiikeivitpvafhdmpllnsvgvhepfalrsiieiitedsyglgesygd
sahldrlqkaadkikglsvystnviyqrcveslrndtngdgmggmvvtasvadkvfspfe
vacldlqgklagisvsdllg

SCOPe Domain Coordinates for d3va8a1:

Click to download the PDB-style file with coordinates for d3va8a1.
(The format of our PDB-style files is described here.)

Timeline for d3va8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3va8a2