Lineage for d3va8a1 (3va8 A:2-136)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948258Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [233834] (1 PDB entry)
  8. 2948259Domain d3va8a1: 3va8 A:2-136 [233835]
    Other proteins in same PDB: d3va8a2, d3va8a3
    automated match to d4it1d1
    complexed with fmt, mg, so4

Details for d3va8a1

PDB Entry: 3va8 (more details), 2 Å

PDB Description: Crystal structure of enolase FG03645.1 (target EFI-502278) from Gibberella zeae PH-1 complexed with magnesium, formate and sulfate
PDB Compounds: (A:) probable dehydratase

SCOPe Domain Sequences for d3va8a1:

Sequence, based on SEQRES records: (download)

>d3va8a1 d.54.1.0 (A:2-136) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
sqrsiikeivitpvafhdmpllnsvgvhepfalrsiieiitedsyglgesygdsahldrl
qkaadkikglsvystnviyqrcveslrndtntggdgmggmvvtasvadkvfspfevacld
lqgklagisvsdllg

Sequence, based on observed residues (ATOM records): (download)

>d3va8a1 d.54.1.0 (A:2-136) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
sqrsiikeivitpvafhdmpllnsvgvhepfalrsiieiitedsyglgesygdsahldrl
qkaadkikglsvystnviyqrcveslrndtngdgmggmvvtasvadkvfspfevacldlq
gklagisvsdllg

SCOPe Domain Coordinates for d3va8a1:

Click to download the PDB-style file with coordinates for d3va8a1.
(The format of our PDB-style files is described here.)

Timeline for d3va8a1: