Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein automated matches [227006] (4 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233826] (5 PDB entries) |
Domain d3v60b1: 3v60 B:1-126 [233827] Other proteins in same PDB: d3v60a_ automated match to d1plqa1 protein/DNA complex; complexed with so4 |
PDB Entry: 3v60 (more details), 2.6 Å
SCOPe Domain Sequences for d3v60b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v60b1 d.131.1.2 (B:1-126) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd idadfl
Timeline for d3v60b1: