Lineage for d3uxlb1 (3uxl B:3-132)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192074Species Pseudomonas putida [TaxId:303] [228629] (6 PDB entries)
  8. 2192087Domain d3uxlb1: 3uxl B:3-132 [233820]
    Other proteins in same PDB: d3uxlc2, d3uxld2
    automated match to d4hncb1
    complexed with cfi, mg

Details for d3uxlb1

PDB Entry: 3uxl (more details), 2.2 Å

PDB Description: P. putida mandelate racemase co-crystallized with the intermediate analogue cupferron
PDB Compounds: (B:) mandelate racemase

SCOPe Domain Sequences for d3uxlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uxlb1 d.54.1.0 (B:3-132) automated matches {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

SCOPe Domain Coordinates for d3uxlb1:

Click to download the PDB-style file with coordinates for d3uxlb1.
(The format of our PDB-style files is described here.)

Timeline for d3uxlb1: