Lineage for d3uxkc1 (3uxk C:3-132)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413212Species Pseudomonas putida [TaxId:303] [228629] (5 PDB entries)
  8. 1413219Domain d3uxkc1: 3uxk C:3-132 [233816]
    Other proteins in same PDB: d3uxka2, d3uxkb2, d3uxkc2, d3uxkd2
    automated match to d4hncb1
    complexed with bho, mg

Details for d3uxkc1

PDB Entry: 3uxk (more details), 2.2 Å

PDB Description: P. putida mandelate racemase co-crystallized with the intermediate analogue benzohydroxamate
PDB Compounds: (C:) mandelate racemase

SCOPe Domain Sequences for d3uxkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uxkc1 d.54.1.0 (C:3-132) automated matches {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

SCOPe Domain Coordinates for d3uxkc1:

Click to download the PDB-style file with coordinates for d3uxkc1.
(The format of our PDB-style files is described here.)

Timeline for d3uxkc1: