SCOPe 2.03: Domain d3ux9d2: 3ux9 D:136-255

Lineage for d3ux9d2 (3ux9 D:136-255)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [230172] (40 PDB entries)

8. Domain d3ux9d2: 3ux9 D:136-255 [233809]
   Other proteins in same PDB: d3ux9a_, d3ux9c_
   automated match to d3esvf2

Details for d3ux9d2

PDB Entry: 3ux9, 2.8 Å

PDB Description: Structural insights into a human anti-IFN antibody exerting therapeutic potential for systemic lupus erythematosus

PDB Compounds: (D:) ScFv antibody

SCOPe Domain Sequences for d3ux9d2:

Sequence; same for both SEQRES and ATOM records:

>d3ux9d2 b.1.1.0 (D:136-255) automated matches {Homo sapiens [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyya
dsvkgrftisrdnskntlylqmnslraedtavyycaryidfgdhmdfwgqgtlvtvssle

Timeline for d3ux9d2:

• d3ux9d2 is new in SCOPe 2.03-stable
  
• d3ux9d2 appears in SCOPe 2.04
  
• d3ux9d2 appears in the current release, SCOPe 2.08