Lineage for d3uwob_ (3uwo B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1598453Species Pseudomonas aeruginosa [TaxId:208964] [226294] (7 PDB entries)
  8. 1598457Domain d3uwob_: 3uwo B: [233807]
    automated match to d3uxmd_
    complexed with 0dj

Details for d3uwob_

PDB Entry: 3uwo (more details), 1.7 Å

PDB Description: Structure Guided Development of Novel Thymidine Mimetics targeting Pseudomonas aeruginosa Thymidylate Kinase: from Hit to Lead Generation
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d3uwob_:

Sequence, based on SEQRES records: (download)

>d3uwob_ c.37.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
glfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepma
adtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesf
vqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqaperyq
vldaglplaevqagldrllpnll

Sequence, based on observed residues (ATOM records): (download)

>d3uwob_ c.37.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
glfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepma
adtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesf
vqgdlrpdltlvfdlpvldrfeqedrrffeavrqtylqraaqaperyqvldaglplaevq
agldrllpnll

SCOPe Domain Coordinates for d3uwob_:

Click to download the PDB-style file with coordinates for d3uwob_.
(The format of our PDB-style files is described here.)

Timeline for d3uwob_: