Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (5 PDB entries) |
Domain d3u9pm2: 3u9p M:108-211 [233772] Other proteins in same PDB: d3u9pc_, d3u9pd_ automated match to d1l7tl2 |
PDB Entry: 3u9p (more details), 2.8 Å
SCOPe Domain Sequences for d3u9pm2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u9pm2 b.1.1.0 (M:108-211) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} radaaptvsifppsseqlatggasvvcfvnnfyprdisvkwkidgterrdgvldsvtdqd skdstysmsstlsltkvdyerhnlytcevvhktssspvvksfnr
Timeline for d3u9pm2:
View in 3D Domains from other chains: (mouse over for more information) d3u9pc_, d3u9pd_, d3u9pl1, d3u9pl2 |