Lineage for d3ttxa2 (3ttx A:598-753)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859353Species Escherichia coli [TaxId:562] [186939] (7 PDB entries)
  8. 2859367Domain d3ttxa2: 3ttx A:598-753 [233740]
    Other proteins in same PDB: d3ttxa1, d3ttxb1, d3ttxc1, d3ttxd1
    automated match to d1p80a1
    complexed with hem

Details for d3ttxa2

PDB Entry: 3ttx (more details), 1.74 Å

PDB Description: Structure of the F413K variant of E. coli KatE
PDB Compounds: (A:) catalase hpii

SCOPe Domain Sequences for d3ttxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ttxa2 c.23.16.0 (A:598-753) automated matches {Escherichia coli [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d3ttxa2:

Click to download the PDB-style file with coordinates for d3ttxa2.
(The format of our PDB-style files is described here.)

Timeline for d3ttxa2: