Class a: All alpha proteins [46456] (284 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (23 species) not a true protein |
Species Coxiella burnetii [TaxId:777] [233715] (1 PDB entry) |
Domain d3trib2: 3tri B:163-271 [233716] Other proteins in same PDB: d3trib1 automated match to d1yqga1 complexed with cl, nap, po4 |
PDB Entry: 3tri (more details), 2.5 Å
SCOPe Domain Sequences for d3trib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3trib2 a.100.1.0 (B:163-271) automated matches {Coxiella burnetii [TaxId: 777]} sedqiekiaalsgsgpayiflimealqeaaeqlgltketaellteqtvlgaarmaleteq svvqlrqfvtspggtteqaikvlesgnlrelfikaltaavnrakelskt
Timeline for d3trib2: