Lineage for d3trib2 (3tri B:163-271)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276308Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1276309Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1276508Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1276509Protein automated matches [226851] (23 species)
    not a true protein
  7. 1276519Species Coxiella burnetii [TaxId:777] [233715] (1 PDB entry)
  8. 1276520Domain d3trib2: 3tri B:163-271 [233716]
    Other proteins in same PDB: d3trib1
    automated match to d1yqga1
    complexed with cl, nap, po4

Details for d3trib2

PDB Entry: 3tri (more details), 2.5 Å

PDB Description: structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii
PDB Compounds: (B:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d3trib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3trib2 a.100.1.0 (B:163-271) automated matches {Coxiella burnetii [TaxId: 777]}
sedqiekiaalsgsgpayiflimealqeaaeqlgltketaellteqtvlgaarmaleteq
svvqlrqfvtspggtteqaikvlesgnlrelfikaltaavnrakelskt

SCOPe Domain Coordinates for d3trib2:

Click to download the PDB-style file with coordinates for d3trib2.
(The format of our PDB-style files is described here.)

Timeline for d3trib2: