Lineage for d3trib1 (3tri B:2-162)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831076Species Coxiella burnetii [TaxId:777] [233713] (1 PDB entry)
  8. 1831078Domain d3trib1: 3tri B:2-162 [233714]
    Other proteins in same PDB: d3tria2, d3trib2
    automated match to d1yqga2
    complexed with cl, nap, po4

Details for d3trib1

PDB Entry: 3tri (more details), 2.5 Å

PDB Description: structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii
PDB Compounds: (B:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d3trib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3trib1 c.2.1.0 (B:2-162) automated matches {Coxiella burnetii [TaxId: 777]}
ntsnitfigggnmarnivvgliangydpnricvtnrsldkldffkekcgvhttqdnrqga
lnadvvvlavkphqikmvceelkdilsetkilvislavgvttpliekwlgkasrivramp
ntpssvragatglfanetvdkdqknlaesimravglviwvs

SCOPe Domain Coordinates for d3trib1:

Click to download the PDB-style file with coordinates for d3trib1.
(The format of our PDB-style files is described here.)

Timeline for d3trib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3trib2