SCOPe 2.08: Domain d3toyb2: 3toy B:133-360

Lineage for d3toyb2 (3toy B:133-360)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Bradyrhizobium sp. [TaxId:114615] [233701] (2 PDB entries)

8. Domain d3toyb2: 3toy B:133-360 [233706]
   Other proteins in same PDB: d3toya1, d3toyb1, d3toyc1, d3toyd1
   automated match to d4hncb2
   complexed with act, ca, ni, p4c

Details for d3toyb2

PDB Entry: 3toy, 1.8 Å

PDB Description: crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium sp. ors278 with calcium and acetate bound

PDB Compounds: (B:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d3toyb2:

Sequence; same for both SEQRES and ATOM records:

>d3toyb2 c.1.11.0 (B:133-360) automated matches {Bradyrhizobium sp. [TaxId: 114615]}
pipaydsygvldarddertlrtacdehgfraikskgghgdlatdeamikglrallgpdia
lmldfnqsldpaeatrriarladydltwieepvpqenlsghaavrerseipiqagenwwf
prgfaeaiaagasdfimpdlmkvggitgwlnvagqadaasipmsshilpeasahvlpvtp
tahflevldfagailteplrvidgkvtakgpglglawnesavakyqvt

Timeline for d3toyb2:

• d3toyb2 first appeared in SCOPe 2.03
  
• d3toyb2 appears in SCOPe 2.07