SCOPe 2.05: Domain d3toya1: 3toy A:2-132

Lineage for d3toya1 (3toy A:2-132)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Bradyrhizobium sp. [TaxId:114615] [233695] (2 PDB entries)

8. Domain d3toya1: 3toy A:2-132 [233696]
   Other proteins in same PDB: d3toya2, d3toyb2, d3toyc2, d3toyd2
   automated match to d4hncb1
   complexed with act, ca, ni, p4c

Details for d3toya1

PDB Entry: 3toy, 1.8 Å

PDB Description: crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium sp. ors278 with calcium and acetate bound

PDB Compounds: (A:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d3toya1:

Sequence; same for both SEQRES and ATOM records:

>d3toya1 d.54.1.0 (A:2-132) automated matches {Bradyrhizobium sp. [TaxId: 114615]}
ttaaitgvtaravitpmkrplrnafgvidsgplvlidvttdqgvtghsylfaytrlalkp
lvhlvedigrelagkalvpvdlmkamdakfrllgwqglvgmavsgldmafwdalgqlagk
pvvellggsar

Timeline for d3toya1:

• d3toya1 first appeared in SCOPe 2.03
  
• d3toya1 appears in SCOPe 2.04
  
• d3toya1 appears in SCOPe 2.06
  
• d3toya1 appears in the current release, SCOPe 2.08