Lineage for d3th3l1 (3th3 L:47-86)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961820Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 1961821Protein automated matches [226968] (3 species)
    not a true protein
  7. 1961822Species Human (Homo sapiens) [TaxId:9606] [225423] (24 PDB entries)
  8. 1961861Domain d3th3l1: 3th3 L:47-86 [233679]
    Other proteins in same PDB: d3th3h_, d3th3l2, d3th3t1, d3th3t2
    automated match to d1danl1
    complexed with 0ge, bgc, ca, cl, fuc

Details for d3th3l1

PDB Entry: 3th3 (more details), 2.7 Å

PDB Description: mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+
PDB Compounds: (L:) Coagulation factor VII light chain

SCOPe Domain Sequences for d3th3l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3th3l1 g.3.11.0 (L:47-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdqcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d3th3l1:

Click to download the PDB-style file with coordinates for d3th3l1.
(The format of our PDB-style files is described here.)

Timeline for d3th3l1: