Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Geobacillus sp. [TaxId:129337] [233669] (4 PDB entries) |
Domain d3tapa1: 3tap A:297-468 [233673] Other proteins in same PDB: d3tapa2 automated match to d1nk4a1 protein/DNA complex; complexed with mg, so4 |
PDB Entry: 3tap (more details), 1.66 Å
SCOPe Domain Sequences for d3tapa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tapa1 c.55.3.0 (A:297-468) automated matches {Geobacillus sp. [TaxId: 129337]} akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
Timeline for d3tapa1: