Lineage for d3tana2 (3tan A:469-876)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2246834Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2247126Protein automated matches [226972] (9 species)
    not a true protein
  7. 2247164Species Geobacillus sp. [TaxId:129337] [233671] (4 PDB entries)
  8. 2247165Domain d3tana2: 3tan A:469-876 [233672]
    Other proteins in same PDB: d3tana1
    automated match to d2hhva2
    protein/DNA complex; complexed with dcp, so4, suc

Details for d3tana2

PDB Entry: 3tan (more details), 1.53 Å

PDB Description: crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-1) position
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d3tana2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tana2 e.8.1.1 (A:469-876) automated matches {Geobacillus sp. [TaxId: 129337]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOPe Domain Coordinates for d3tana2:

Click to download the PDB-style file with coordinates for d3tana2.
(The format of our PDB-style files is described here.)

Timeline for d3tana2: