| Class g: Small proteins [56992] (98 folds) |
| Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) ![]() |
| Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
| Protein automated matches [190046] (3 species) not a true protein |
| Species Sea anemone (Stichodactyla helianthus) [TaxId:6123] [189666] (4 PDB entries) |
| Domain d3t62d_: 3t62 D: [233668] Other proteins in same PDB: d3t62a_, d3t62b_, d3t62c_ automated match to d3m7qb_ complexed with so4 |
PDB Entry: 3t62 (more details), 2 Å
SCOPe Domain Sequences for d3t62d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t62d_ g.8.1.1 (D:) automated matches {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]}
sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicr
Timeline for d3t62d_: