SCOPe 2.03: Domain d3t4nc2: 3t4n C:187-322

Lineage for d3t4nc2 (3t4n C:187-322)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (10 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:559292] [233658] (1 PDB entry)

8. Domain d3t4nc2: 3t4n C:187-322 [233660]
   Other proteins in same PDB: d3t4na_
   automated match to d2ooxe2
   complexed with adp

Details for d3t4nc2

PDB Entry: 3t4n, 2.3 Å

PDB Description: Structure of the regulatory fragment of Saccharomyces cerevisiae AMPK in complex with ADP

PDB Compounds: (C:) Nuclear protein SNF4

SCOPe Domain Sequences for d3t4nc2:

Sequence; same for both SEQRES and ATOM records:

>d3t4nc2 d.37.1.0 (C:187-322) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
ipigdlniitqdnmkscqmttpvidviqmltqgrvssvpiidengylinvyeaydvlgli
kggiyndlslsvgealmrrsddfegvytctkndklstimdnirkarvhrffvvddvgrlv
gvltlsdilkyillgs

Timeline for d3t4nc2:

• d3t4nc2 is new in SCOPe 2.03-stable
  
• d3t4nc2 appears in SCOPe 2.04
  
• d3t4nc2 appears in the current release, SCOPe 2.08