SCOPe 2.05: Domain d1siea_: 1sie A:

Lineage for d1siea_ (1sie A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families)

5. Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)

6. Protein Polyomavirus coat proteins [49657] (2 species)

7. Species Murine polyomavirus, strain small-plaque 16 [TaxId:10634] [49658] (11 PDB entries)

8. Domain d1siea_: 1sie A: [23357]

Details for d1siea_

PDB Entry: 1sie, 3.65 Å

PDB Description: murine polyomavirus complexed with a disialylated oligosaccharide

PDB Compounds: (A:) polyomavirus coat protein vp1

SCOPe Domain Sequences for d1siea_:

Sequence; same for both SEQRES and ATOM records:

>d1siea_ b.121.6.1 (A:) Polyomavirus coat proteins {Murine polyomavirus, strain small-plaque 16 [TaxId: 10634]}
kacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygws
rginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgsll
dvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtikti
tkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqft
ntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
npypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepvpgdpdmtryvdrfgkt
ktvfpg

Timeline for d1siea_:

• d1siea_ first appeared (with stable ids) in SCOP 1.55
  
• d1siea_ appears in SCOPe 2.04
  
• d1siea_ appears in SCOPe 2.06
  
• d1siea_ appears in the current release, SCOPe 2.08