Lineage for d1sidf_ (1sid F:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11605Protein Murine polyomavirus coat protein vp1 [49657] (1 species)
  7. 11606Species Murine polyoma virus, strain small-plaque 16 [49658] (5 PDB entries)
  8. 11627Domain d1sidf_: 1sid F: [23356]

Details for d1sidf_

PDB Entry: 1sid (more details), 3.65 Å

PDB Description: murine polyomavirus complexed with 3'sialyl lactose

SCOP Domain Sequences for d1sidf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sidf_ b.10.1.4 (F:) Murine polyomavirus coat protein vp1 {Murine polyoma virus, strain small-plaque 16}
acprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsr
ginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslld
vhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktit
kkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftn
tlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvkn
pypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepvpgdpdmtryvd

SCOP Domain Coordinates for d1sidf_:

Click to download the PDB-style file with coordinates for d1sidf_.
(The format of our PDB-style files is described here.)

Timeline for d1sidf_: