Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries) |
Domain d3sbda_: 3sbd A: [233527] automated match to d3sbea_ complexed with gnp, mg; mutant |
PDB Entry: 3sbd (more details), 2.1 Å
SCOPe Domain Sequences for d3sbda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sbda_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gqaikcvvvgdgavgktcllisyttnafsgeyiptvfdnysanvmvdgkpvnlglwdtag qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl
Timeline for d3sbda_: