Lineage for d3sbda_ (3sbd A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363774Protein automated matches [190047] (16 species)
    not a true protein
  7. 1363812Species Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries)
  8. 1363956Domain d3sbda_: 3sbd A: [233527]
    automated match to d3sbea_
    complexed with gnp, mg; mutant

Details for d3sbda_

PDB Entry: 3sbd (more details), 2.1 Å

PDB Description: Crystal structure of RAC1 P29S mutant
PDB Compounds: (A:) ras-related c3 botulinum toxin substrate 1

SCOPe Domain Sequences for d3sbda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbda_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqaikcvvvgdgavgktcllisyttnafsgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl

SCOPe Domain Coordinates for d3sbda_:

Click to download the PDB-style file with coordinates for d3sbda_.
(The format of our PDB-style files is described here.)

Timeline for d3sbda_:

  • d3sbda_ appears in periodic updates to SCOPe 2.03 starting on 2014-01-12
  • d3sbda_ appears in SCOPe 2.04
  • d3sbda_ appears in the current release, SCOPe 2.07, called d3sbda1