SCOPe 2.08: Domain d3s9dd1: 3s9d D:11-109

Lineage for d3s9dd1 (3s9d D:11-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)

8. Domain d3s9dd1: 3s9d D:11-109 [233522]
   Other proteins in same PDB: d3s9da_, d3s9dc_
   automated match to d2hyma1
   complexed with cl

Details for d3s9dd1

PDB Entry: 3s9d, 2 Å

PDB Description: binary complex between IFNa2 and IFNAR2

PDB Compounds: (D:) Interferon alpha/beta receptor 2

SCOPe Domain Sequences for d3s9dd1:

Sequence; same for both SEQRES and ATOM records:

>d3s9dd1 b.1.2.1 (D:11-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncanttrsfcdltd
ewrstheayvtvlegfsgnttlfscshnfwlaidmsfep

Timeline for d3s9dd1:

• d3s9dd1 first appeared in SCOPe 2.03
  
• d3s9dd1 appears in SCOPe 2.07