Lineage for d3rrva_ (3rrv A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113336Species Mycobacterium avium [TaxId:1770] [189738] (3 PDB entries)
  8. 2113346Domain d3rrva_: 3rrv A: [233491]
    Other proteins in same PDB: d3rrvb2, d3rrve2, d3rrvf2
    automated match to d2ej5a_
    complexed with ca, cl, edo

Details for d3rrva_

PDB Entry: 3rrv (more details), 2.45 Å

PDB Description: crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium paratuberculosis
PDB Compounds: (A:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3rrva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rrva_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}
ydmpteidvradgalriitlnrpdslnsvnddlhvglarlwqrltddptaraavitgagr
afsaggdfgylkelsadadlraktirdgreivlgmarcripvvaavngpavglgcslval
sdivyiaenayladphvqvglvaadggpltwplhislllakeyaltgtrisaqravelgl
anhvaddpvaeaiacakkilelpqqavestkrvlnihleravlasldyalsaesqsfvte
dfrsivtkladkn

SCOPe Domain Coordinates for d3rrva_:

Click to download the PDB-style file with coordinates for d3rrva_.
(The format of our PDB-style files is described here.)

Timeline for d3rrva_: