SCOPe 2.08: Domain d3rn2b2: 3rn2 B:250-339

Lineage for d3rn2b2 (3rn2 B:250-339)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families)
   duplication: tandem repeat of two OB-fold domains

5. Family b.40.16.0: automated matches [233467] (1 protein)
   not a true family

6. Protein automated matches [233468] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [233469] (2 PDB entries)

8. Domain d3rn2b2: 3rn2 B:250-339 [233475]
   automated match to d2oq0a1
   protein/DNA complex; complexed with edo

Details for d3rn2b2

PDB Entry: 3rn2, 2.55 Å

PDB Description: Structural Basis of Cytosolic DNA Recognition by Innate Immune Receptors

PDB Compounds: (B:) Interferon-inducible protein AIM2

SCOPe Domain Sequences for d3rn2b2:

Sequence; same for both SEQRES and ATOM records:

>d3rn2b2 b.40.16.0 (B:250-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkintlqtqplgtivnglfvvqkvtekkknilfdlsdntgkmevlgvrnedtmkckegdk
vrltfftlskngeklqltsgvhstikvika

Timeline for d3rn2b2:

• d3rn2b2 first appeared in SCOPe 2.03
  
• d3rn2b2 appears in SCOPe 2.07