Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins) automatically mapped to Pfam PF00891 |
Protein automated matches [226979] (2 species) not a true protein |
Species Clarkia breweri [TaxId:36903] [226318] (5 PDB entries) |
Domain d3reoc2: 3reo C:123-367 [233443] Other proteins in same PDB: d3reoa1, d3reob1, d3reoc1, d3reod1 automated match to d3tkyd2 complexed with eug, sah |
PDB Entry: 3reo (more details), 1.9 Å
SCOPe Domain Sequences for d3reoc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3reoc2 c.66.1.12 (C:123-367) automated matches {Clarkia breweri [TaxId: 36903]} dgvslapflllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfnkg mssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviqda pafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyi lppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvm eflkt
Timeline for d3reoc2: