SCOPe 2.04: Domain d3reoc2: 3reo C:123-367

Lineage for d3reoc2 (3reo C:123-367)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
   automatically mapped to Pfam PF00891

6. Protein automated matches [226979] (2 species)
   not a true protein

7. Species Clarkia breweri [TaxId:36903] [226318] (2 PDB entries)

8. Domain d3reoc2: 3reo C:123-367 [233443]
   Other proteins in same PDB: d3reoa1, d3reob1, d3reoc1, d3reod1
   automated match to d3tkyd2
   complexed with eug, sah

Details for d3reoc2

PDB Entry: 3reo, 1.9 Å

PDB Description: monolignol o-methyltransferase (momt)

PDB Compounds: (C:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d3reoc2:

Sequence; same for both SEQRES and ATOM records:

>d3reoc2 c.66.1.12 (C:123-367) automated matches {Clarkia breweri [TaxId: 36903]}
dgvslapflllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfnkg
mssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviqda
pafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyi
lppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvm
eflkt

Timeline for d3reoc2:

• d3reoc2 first appeared in SCOPe 2.03
  
• d3reoc2 appears in SCOPe 2.05
  
• d3reoc2 appears in the current release, SCOPe 2.08