Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (41 species) not a true protein |
Species Clarkia breweri [TaxId:36903] [226317] (2 PDB entries) |
Domain d3reod1: 3reo D:9-122 [233440] Other proteins in same PDB: d3reoa2, d3reob2, d3reoc2, d3reod2 automated match to d3tkyd1 complexed with eug, sah |
PDB Entry: 3reo (more details), 1.9 Å
SCOPe Domain Sequences for d3reod1:
Sequence, based on SEQRES records: (download)
>d3reod1 a.4.5.0 (D:9-122) automated matches {Clarkia breweri [TaxId: 36903]} iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaq lpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne
>d3reod1 a.4.5.0 (D:9-122) automated matches {Clarkia breweri [TaxId: 36903]} iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvgyispaeiaaqlpt tnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne
Timeline for d3reod1: