SCOPe 2.04: Domain d3r66c1: 3r66 C:4-78

Lineage for d3r66c1 (3r66 C:4-78)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (41 PDB entries)

8. Domain d3r66c1: 3r66 C:4-78 [233409]
   Other proteins in same PDB: d3r66a_, d3r66b_, d3r66c2, d3r66d2
   automated match to d1z2ma1

Details for d3r66c1

PDB Entry: 3r66, 2.3 Å

PDB Description: crystal structure of human isg15 in complex with ns1 n-terminal region from influenza virus b, northeast structural genomics consortium target ids hx6481, hr2873, and or2

PDB Compounds: (C:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d3r66c1:

Sequence; same for both SEQRES and ATOM records:

>d3r66c1 d.15.1.0 (C:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq
glgpgstvllvvdkc

Timeline for d3r66c1:

• d3r66c1 first appeared in SCOPe 2.03
  
• d3r66c1 appears in SCOPe 2.05
  
• d3r66c1 appears in the current release, SCOPe 2.08