Lineage for d1vpsd_ (1vps D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1563153Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1564135Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 1564136Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 1564140Protein Polyomavirus coat proteins [49657] (2 species)
  7. 1564141Species Murine polyomavirus, strain small-plaque 16 [TaxId:10634] [49658] (5 PDB entries)
  8. 1564145Domain d1vpsd_: 1vps D: [23339]

Details for d1vpsd_

PDB Entry: 1vps (more details), 1.9 Å

PDB Description: polyomavirus vp1 pentamer complexed with a disialylated hexasaccharide
PDB Compounds: (D:) polyomavirus vp1 pentamer

SCOPe Domain Sequences for d1vpsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpsd_ b.121.6.1 (D:) Polyomavirus coat proteins {Murine polyomavirus, strain small-plaque 16 [TaxId: 10634]}
ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk

SCOPe Domain Coordinates for d1vpsd_:

Click to download the PDB-style file with coordinates for d1vpsd_.
(The format of our PDB-style files is described here.)

Timeline for d1vpsd_: