Lineage for d3r06l2 (3r06 L:108-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764937Species Cricetulus migratorius [TaxId:10032] [225940] (5 PDB entries)
  8. 1764945Domain d3r06l2: 3r06 L:108-213 [233384]
    automated match to d1l7tl2

Details for d3r06l2

PDB Entry: 3r06 (more details), 2.5 Å

PDB Description: Crystal structure of anti-mouse CD3epsilon antibody 2C11 Fab fragment
PDB Compounds: (L:) anti-mouse CD3epsilon antibody 2C11 Fab light chain

SCOPe Domain Sequences for d3r06l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r06l2 b.1.1.0 (L:108-213) automated matches {Cricetulus migratorius [TaxId: 10032]}
radakptvsifppsseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqd
skdstyslsstlsltkadyerhnlytcevthktstaaivktlnrne

SCOPe Domain Coordinates for d3r06l2:

Click to download the PDB-style file with coordinates for d3r06l2.
(The format of our PDB-style files is described here.)

Timeline for d3r06l2: