Lineage for d3qw6a_ (3qw6 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205348Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2205349Protein Botulinum neurotoxin [55513] (4 species)
  7. 2205350Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (26 PDB entries)
    Uniprot P10845 1-419
  8. 2205356Domain d3qw6a_: 3qw6 A: [233370]
    automated match to d4ej5a_
    complexed with na, so4, zn

Details for d3qw6a_

PDB Entry: 3qw6 (more details), 1.6 Å

PDB Description: Crystal structure of the protease domain of Botulinum Neurotoxin Serotype A with a peptide inhibitor RYGC
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d3qw6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qw6a_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
pfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpnr
vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
nrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftg
lf

SCOPe Domain Coordinates for d3qw6a_:

Click to download the PDB-style file with coordinates for d3qw6a_.
(The format of our PDB-style files is described here.)

Timeline for d3qw6a_: